Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00046538-protein ID=TCONS_00046538-protein|Name=TCONS_00046538-protein|organism=Clytia hemisphaerica|type=polypeptide|length=203bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00046538-protein vs. Swiss-Prot (Human)
Match: F133B (Protein FAM133B OS=Homo sapiens GN=FAM133B PE=1 SV=1) HSP 1 Score: 102.834 bits (255), Expect = 6.212e-27 Identity = 43/83 (51.81%), Postives = 66/83 (79.52%), Query Frame = 0 Query: 1 MGKRDTRVAFVNPVAASRSSGPAQG-GPSIKDYLSRPRPSWDELKEQIKATRKGSRTLEQFEKERNMDYRAELDRGREKFFNS 82 MGKRD RVA++NP+A +RS GP Q GP+I+DYL+RPRP+W+E+KEQ++ +KGS+ L +FE++ N +++ EL++ REK + Sbjct: 1 MGKRDNRVAYMNPIAMARSRGPIQSSGPTIQDYLNRPRPTWEEVKEQLEKKKKGSKALAEFEEKMNENWKKELEKHREKLLSG 83 The following BLAST results are available for this feature:
BLAST of TCONS_00046538-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|