Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00046538 ID=TCONS_00046538|Name=TCONS_00046538|organism=Clytia hemisphaerica|type=transcript|length=1716bpRun BLAST on NCBI protein sequence of TCONS_00046538-protein >TCONS_00046538-protein ID=TCONS_00046538-protein|Name=TCONS_00046538-protein|organism=Clytia hemisphaerica|type=polypeptide|length=203bp MGKRDTRVAFVNPVAASRSSGPAQGGPSIKDYLSRPRPSWDELKEQIKATRun BLAST on NCBI transcript from alignment at scaffold_113:265734..273856- Legend: exonfive_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00046538 ID=TCONS_00046538|Name=TCONS_00046538|organism=Clytia hemisphaerica|type=transcript|length=8123bp|location=Sequence derived from alignment at scaffold_113:265734..273856- (Clytia hemisphaerica) Coding sequence (CDS) from alignment at scaffold_113:265734..273856- >TCONS_00046538 ID=TCONS_00046538|Name=TCONS_00046538|organism=Clytia hemisphaerica|type=CDS|length=6120bp|location=Sequence derived from alignment at scaffold_113:265734..273856- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00046538 vs. Swiss-Prot (Human)
Match: F133B (Protein FAM133B OS=Homo sapiens GN=FAM133B PE=1 SV=1) HSP 1 Score: 99.7525 bits (247), Expect = 3.357e-23 Identity = 43/81 (53.09%), Postives = 65/81 (80.25%), Query Frame = 2 Query: 83 MGKRDTRVAFVNPVAASRSSGPAQG-GPSIKDYLSRPRPSWDELKEQIKATRKGSRTLEQFEKERNMDYRAELDRGREKFF 322 MGKRD RVA++NP+A +RS GP Q GP+I+DYL+RPRP+W+E+KEQ++ +KGS+ L +FE++ N +++ EL++ REK Sbjct: 1 MGKRDNRVAYMNPIAMARSRGPIQSSGPTIQDYLNRPRPTWEEVKEQLEKKKKGSKALAEFEEKMNENWKKELEKHREKLL 81 The following BLAST results are available for this feature:
BLAST of TCONS_00046538 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|