Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00053448-protein ID=TCONS_00053448-protein|Name=TCONS_00053448-protein|organism=Clytia hemisphaerica|type=polypeptide|length=526bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00053448-protein vs. Swiss-Prot (Human)
Match: SRS11 (Serine/arginine-rich splicing factor 11 OS=Homo sapiens GN=SRSF11 PE=1 SV=1) HSP 1 Score: 101.293 bits (251), Expect = 8.431e-23 Identity = 43/100 (43.00%), Postives = 69/100 (69.00%), Query Frame = 0 Query: 62 KVVRISNVSSGATLQQLATLFGYLGTIQDIRMYPTEENPT-IKIRLCYIKFDTSEQCGVAQHLTNTVFIDKPLIVVPMNREEIPEEKDCQHLISTINAYA 160 +V++++NVS A+ +Q+ TLFG+LG I ++R++P +++P + R+C++KF + VAQHLTNTVF+D+ LIVVP IP+E L++ NA A Sbjct: 33 EVIQVTNVSPSASSEQMRTLFGFLGKIDELRLFPPDDSPLPVSSRVCFVKFHDPDSAVVAQHLTNTVFVDRALIVVPYAEGVIPDEAKALSLLAPANAVA 132 The following BLAST results are available for this feature:
BLAST of TCONS_00053448-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|