Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00054073-protein ID=TCONS_00054073-protein|Name=TCONS_00054073-protein|organism=Clytia hemisphaerica|type=polypeptide|length=185bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00054073-protein vs. Swiss-Prot (Human)
Match: MRP3 (Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3) HSP 1 Score: 74.7146 bits (182), Expect = 5.996e-16 Identity = 42/135 (31.11%), Postives = 76/135 (56.30%), Query Frame = 0 Query: 52 VKDVDGKDEGKIIEKEKAETGNLKAAVISHYVRTLGIIATTILLLSAILQEAFRIASRVWLAHWSSLPLQTSKTSR-NLFLRLYALLGFIQAFFVLLLALVLAIASYKSSKKLHSELLDTIMHCPMAFFEATPIG 185 V+ + K +G + ++EKA G ++ +V Y + +G+ T + L + Q A I + VWL+ W++ + S+ + +L L +YA LG +Q F V+L A+ +A ++++ LH LL + P +FF+ TP G Sbjct: 932 VQVTEAKADGALTQEEKAAIGTVELSVFWDYAKAVGLCTTLAICLLYVGQSAAAIGANVWLSAWTNDAMADSRQNNTSLRLGVYAALGILQGFLVMLAAMAMAAGGIQAARVLHQALLHNKIRSPQSFFDTTPSG 1066 The following BLAST results are available for this feature:
BLAST of TCONS_00054073-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|