Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00054222-protein ID=TCONS_00054222-protein|Name=TCONS_00054222-protein|organism=Clytia hemisphaerica|type=polypeptide|length=392bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00054222-protein vs. Swiss-Prot (Human)
Match: EMX1 (Homeobox protein EMX1 OS=Homo sapiens GN=EMX1 PE=1 SV=2) HSP 1 Score: 95.1301 bits (235), Expect = 2.291e-22 Identity = 44/63 (69.84%), Postives = 53/63 (84.13%), Query Frame = 0 Query: 302 GKKRRRHRTAFTPTQLLGLENSFERGHYLVGDERKQLAAFLRLSETQIKVWFQNRRTKYKRQR 364 +K +R RTAF+P+QLL LE +FE+ HY+VG ERKQLA L LSETQ+KVWFQNRRTKYKRQ+ Sbjct: 156 ARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSLSETQVKVWFQNRRTKYKRQK 218 The following BLAST results are available for this feature:
BLAST of TCONS_00054222-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|