Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00054604-protein ID=TCONS_00054604-protein|Name=TCONS_00054604-protein|organism=Clytia hemisphaerica|type=polypeptide|length=104bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00054604-protein vs. Swiss-Prot (Human)
Match: ZCH24 (Zinc finger CCHC domain-containing protein 24 OS=Homo sapiens GN=ZCCHC24 PE=1 SV=1) HSP 1 Score: 97.4413 bits (241), Expect = 2.009e-26 Identity = 45/81 (55.56%), Postives = 56/81 (69.14%), Query Frame = 0 Query: 9 TKYQGSKRMFGQFRCPKCNRTWASGNTWANTAQQCQSCLIDVFPYHQQRLERPSVL--TGPGKEHPQHLWGMCKRLGRYCR 87 T YQG KR FG+++CPKC R W SGN+WAN Q+C C I+V+P+ Q+ LE+P L + KEHPQHL CK LG YCR Sbjct: 158 TPYQGKKRCFGEYKCPKCKRKWMSGNSWANMGQECIKCHINVYPHKQRPLEKPDGLDVSDQSKEHPQHLCEKCKVLGYYCR 238 The following BLAST results are available for this feature:
BLAST of TCONS_00054604-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|