Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00057510-protein ID=TCONS_00057510-protein|Name=TCONS_00057510-protein|organism=Clytia hemisphaerica|type=polypeptide|length=208bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00057510-protein vs. Swiss-Prot (Human)
Match: RFOX1 (RNA binding protein fox-1 homolog 1 OS=Homo sapiens GN=RBFOX1 PE=1 SV=2) HSP 1 Score: 90.1225 bits (222), Expect = 2.343e-21 Identity = 40/62 (64.52%), Postives = 48/62 (77.42%), Query Frame = 0 Query: 2 YGSVLDAEIIYNERGSKGFGFVTMETSEDASKAKEALHGKEIDGRKIEVNKATPRTNTSKVT 63 +G +LD EII+NERGSKGFGFVT E S DA +A+E LHG ++GRKIEVN AT R T+K T Sbjct: 140 FGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKT 201 The following BLAST results are available for this feature:
BLAST of TCONS_00057510-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|