Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00058844-protein ID=TCONS_00058844-protein|Name=TCONS_00058844-protein|organism=Clytia hemisphaerica|type=polypeptide|length=129bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00058844-protein vs. Swiss-Prot (Human)
Match: GP107 (Protein GPR107 OS=Homo sapiens GN=GPR107 PE=1 SV=1) HSP 1 Score: 82.8037 bits (203), Expect = 1.398e-19 Identity = 44/108 (40.74%), Postives = 67/108 (62.04%), Query Frame = 0 Query: 19 VSKKCHGKESNESQIALNHDNVSFFAMFDITINCPNQAGLYNLYFHNCMNYDV-AEAIKIDLNLKITERNQGTYLSAGQIPLPTLYFWLSFAFFIAAVCWTVYLRKRR 125 V K G++S + N VSF F+I+ + +Q GLY+LYFH C+ ++ ++ L+++ITE+N +YLSAG+IPLP LY ++F FF++ W LRKRR Sbjct: 185 VDSKAMGEKS--FSVHNNGGAVSFQFFFNISTD--DQEGLYSLYFHKCLGKELPSDKFTFSLDIEITEKNPDSYLSAGEIPLPKLYISMAFFFFLSGTIWIHILRKRR 288 The following BLAST results are available for this feature:
BLAST of TCONS_00058844-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|