Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00061697-protein ID=TCONS_00061697-protein|Name=TCONS_00061697-protein|organism=Clytia hemisphaerica|type=polypeptide|length=200bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00061697-protein vs. Swiss-Prot (Human)
Match: TRPM3 (Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens GN=TRPM3 PE=2 SV=4) HSP 1 Score: 84.7297 bits (208), Expect = 3.466e-19 Identity = 40/87 (45.98%), Postives = 60/87 (68.97%), Query Frame = 0 Query: 30 PCPDEIGQKIVPIYMAIYMLMTNILLLNLLIAIFNNTYEKVQENSDRLWKFKRYDVISEYNDRPSFCPPFIVLAHIWFFGLFLFRCC 116 PC + G IVP MA Y+L+ NILL+NLLIA+FNNT+ +V+ S+++WKF+RY +I +++RP PP I+ +H+ +F CC Sbjct: 1106 PC--KTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTM--IFQHLCC 1188 The following BLAST results are available for this feature:
BLAST of TCONS_00061697-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|