Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00062510-protein ID=TCONS_00062510-protein|Name=TCONS_00062510-protein|organism=Clytia hemisphaerica|type=polypeptide|length=314bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00062510-protein vs. Swiss-Prot (Human)
Match: CS047 (Uncharacterized protein C19orf47 OS=Homo sapiens GN=C19orf47 PE=1 SV=1) HSP 1 Score: 83.1889 bits (204), Expect = 8.148e-18 Identity = 33/64 (51.56%), Postives = 48/64 (75.00%), Query Frame = 0 Query: 8 WEKFFKEAGIPGKLVSDYANVFCDNRMRLDMLEELNKEVLQELGIKAVGDIIAILRYSKIKQKE 71 W +FFKEAGIP +YA +F DNR++ ML +LNKE++ ELG+ VGDIIAIL+++K+ ++ Sbjct: 48 WIQFFKEAGIPPGPAVNYAVMFVDNRIQKSMLLDLNKEIMNELGVTVVGDIIAILKHAKVVHRQ 111 The following BLAST results are available for this feature:
BLAST of TCONS_00062510-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|