Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00062553-protein ID=TCONS_00062553-protein|Name=TCONS_00062553-protein|organism=Clytia hemisphaerica|type=polypeptide|length=160bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00062553-protein vs. Swiss-Prot (Human)
Match: KCIP1 (Kv channel-interacting protein 1 OS=Homo sapiens GN=KCNIP1 PE=1 SV=2) HSP 1 Score: 80.4925 bits (197), Expect = 3.066e-19 Identity = 35/72 (48.61%), Postives = 48/72 (66.67%), Query Frame = 0 Query: 76 GLDGLIRETNFTREEIQRMYRGFKQECPRGLLDEETFLAILNMLFPGGDPTLYCSRIFNTFDRRKTGKLTFE 147 GL+ L +TNFT+ E+Q +YRGFK ECP G+++E+TF I FP GD + Y +FN FD +TG + FE Sbjct: 49 GLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFE 120 The following BLAST results are available for this feature:
BLAST of TCONS_00062553-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|