Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00062807-protein ID=TCONS_00062807-protein|Name=TCONS_00062807-protein|organism=Clytia hemisphaerica|type=polypeptide|length=127bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00062807-protein vs. Swiss-Prot (Human)
Match: RPAC2 (DNA-directed RNA polymerases I and III subunit RPAC2 OS=Homo sapiens GN=POLR1D PE=1 SV=1) HSP 1 Score: 120.939 bits (302), Expect = 1.764e-36 Identity = 55/97 (56.70%), Postives = 69/97 (71.13%), Query Frame = 0 Query: 23 GEDETCVTYVMHHEDHTIGNSLRYMILKNPEVEYCGYSVPHPSEEKINLRIQT-SSKPAVEVLKTGLVNLQKVSLHALDTFQEAVMNFKQNRKENNE 118 G D CVT+V+H EDHT+GNSLRYMI+KNPEVE+CGY+ HPSE KINLRIQT + PAVE + GL L V H LD F+ ++ ++K + NE Sbjct: 34 GTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNE 130 The following BLAST results are available for this feature:
BLAST of TCONS_00062807-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|