Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00063805-protein ID=TCONS_00063805-protein|Name=TCONS_00063805-protein|organism=Clytia hemisphaerica|type=polypeptide|length=218bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00063805-protein vs. Swiss-Prot (Human)
Match: HRSL4 (Retinoic acid receptor responder protein 3 OS=Homo sapiens GN=RARRES3 PE=1 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 3.089e-18 Identity = 40/121 (33.06%), Postives = 63/121 (52.07%), Query Frame = 0 Query: 46 QPGDLVQVKGRYIWQWFYSHFAVYIGNGNIVHINKPGDKKQGGK----------VWVERRDMVTEFMGKDVRKNNTMDGSFNARRVQDIVKEAKSYVGEKWDYSFLYNNCEHFASMCRYGR 156 +PGDL++ I++ Y H+A+YIG+G ++H+ P + G V+R + G R NN++D + R V+ I+ AK VG+K YS + NCEHF + RYG+ Sbjct: 9 KPGDLIE-----IFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGK 124 The following BLAST results are available for this feature:
BLAST of TCONS_00063805-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|