Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00063950-protein ID=TCONS_00063950-protein|Name=TCONS_00063950-protein|organism=Clytia hemisphaerica|type=polypeptide|length=285bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00063950-protein vs. Swiss-Prot (Human)
Match: FGF1 (Fibroblast growth factor 1 OS=Homo sapiens GN=FGF1 PE=1 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 1.254e-16 Identity = 38/122 (31.15%), Postives = 60/122 (49.18%), Query Frame = 0 Query: 153 SKTGLYLRMGPNGELGGTRKMKDKHVIFVIERMSKDAVRLKGEAANKYICINKRRKLFTREKPNSKCLLRSYLEENHYELFWSYMYSKKTDGENGWFLALKRNGKIRKPANTKIGDRQTMFF 274 S G +LR+ P+G + GTR D+H+ + S V +K +Y+ ++ L+ + PN +CL LEENHY + S K E WF+ LK+NG ++ T G + +F Sbjct: 32 SNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYIS-----KKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFL 148 The following BLAST results are available for this feature:
BLAST of TCONS_00063950-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|