Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00065170-protein ID=TCONS_00065170-protein|Name=TCONS_00065170-protein|organism=Clytia hemisphaerica|type=polypeptide|length=162bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00065170-protein vs. Swiss-Prot (Human)
Match: MRC2 (C-type mannose receptor 2 OS=Homo sapiens GN=MRC2 PE=1 SV=2) HSP 1 Score: 73.559 bits (179), Expect = 8.433e-16 Identity = 36/113 (31.86%), Postives = 60/113 (53.10%), Query Frame = 0 Query: 39 YLIKKTPLNMHAAKEACAKCGGFLATIDDLPEHHFLVHELQKLHIKSAWVGLNDKAYEKVFRWDGSNLPGFKKWCPHEPNNFGNA-EDCVELIADKKCLNDLGCAHARPYICE 150 Y ++ + +K+AC + GG L +I + E F+ ++++ ++ W+GLND + F W +L F W P EPNNF ++ EDCV + + ND C + P IC+ Sbjct: 394 YRLQAEKRSWQESKKACLRGGGDLVSIHSMAELEFITKQIKQ-EVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICK 505 The following BLAST results are available for this feature:
BLAST of TCONS_00065170-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|