Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00066169-protein ID=TCONS_00066169-protein|Name=TCONS_00066169-protein|organism=Clytia hemisphaerica|type=polypeptide|length=207bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00066169-protein vs. Swiss-Prot (Human)
Match: LIN52 (Protein lin-52 homolog OS=Homo sapiens GN=LIN52 PE=1 SV=1) HSP 1 Score: 100.908 bits (250), Expect = 1.134e-27 Identity = 50/104 (48.08%), Postives = 74/104 (71.15%), Query Frame = 0 Query: 107 ERLDQSSPELWPETIPGVSEFTAS---SLFNSPPKPVLNTTMSQLKDSKLTLEDLEMLQEFGNLSLIQLMEKFHNLKNQAYQVGLEESREMTRGRYLNVLGKKK 207 E+LD++SP+LWPE +PGV+EF AS + +SPPK + +++ +D++ML+E G+L+ LMEK L+N AYQ+GL+ESREMTRG++LN+L K K Sbjct: 22 EKLDRASPDLWPEQLPGVAEFAASFKSPITSSPPKWM----------AEIERDDIDMLKELGSLTTANLMEKVRGLQNLAYQLGLDESREMTRGKFLNILEKPK 115 The following BLAST results are available for this feature:
BLAST of TCONS_00066169-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|