Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00066703-protein ID=TCONS_00066703-protein|Name=TCONS_00066703-protein|organism=Clytia hemisphaerica|type=polypeptide|length=352bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00066703-protein vs. Swiss-Prot (Human)
Match: BIN2 (Bridging integrator 2 OS=Homo sapiens GN=BIN2 PE=1 SV=3) HSP 1 Score: 85.5001 bits (210), Expect = 3.489e-18 Identity = 37/79 (46.84%), Postives = 54/79 (68.35%), Query Frame = 0 Query: 1 QVEDEYQKAKDIFIDMTSELYEELPALYDSRIGFYVSCFQSIFTLEEVFHREAAELNHNLNDLMDQLIADFSAGTFSTR 79 + E+E+ KA+ +F D+ EL EELP LY+SRIG YV+ FQ+I L +VF+RE ++LNHNL ++M +L S F + Sbjct: 172 KAEEEFNKAQTVFEDLNQELLEELPILYNSRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKLEKQHSNKVFVVK 250 The following BLAST results are available for this feature:
BLAST of TCONS_00066703-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|