Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00067513-protein ID=TCONS_00067513-protein|Name=TCONS_00067513-protein|organism=Clytia hemisphaerica|type=polypeptide|length=126bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00067513-protein vs. Swiss-Prot (Human)
Match: KPB1 (Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform OS=Homo sapiens GN=PHKA1 PE=1 SV=2) HSP 1 Score: 106.301 bits (264), Expect = 8.037e-28 Identity = 55/100 (55.00%), Postives = 67/100 (67.00%), Query Frame = 0 Query: 4 SKQRLSLHEYYILVKRTILDFQNPITGLLPPSLFHGKFNETTNRHSWVRDNVYSILAVWALSRAYKKKTDFDAEKSKQYELEQSVVKLMRGLLMSMMQQI 103 S + L Y LV++TIL QNP+TGLLP S + +WVRDNVYSILAVW L AY+K D D +K+K YELEQSVVKLMRGLL M++Q+ Sbjct: 5 SNSGVRLDGYARLVQQTILCHQNPVTGLLPASY--------DQKDAWVRDNVYSILAVWGLGLAYRKNADRDEDKAKAYELEQSVVKLMRGLLHCMIRQV 96 The following BLAST results are available for this feature:
BLAST of TCONS_00067513-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|