Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00069615-protein ID=TCONS_00069615-protein|Name=TCONS_00069615-protein|organism=Clytia hemisphaerica|type=polypeptide|length=362bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00069615-protein vs. Swiss-Prot (Human)
Match: RT31 (28S ribosomal protein S31, mitochondrial OS=Homo sapiens GN=MRPS31 PE=1 SV=3) HSP 1 Score: 84.3445 bits (207), Expect = 4.563e-18 Identity = 38/86 (44.19%), Postives = 60/86 (69.77%), Query Frame = 0 Query: 277 WNFPIDNEQDIGIEEETGFDEHVFLDHLLEEFPEEGPVYKFIELVITGLQQNPHLTVEEKTNQVLWFKEYFDKFPEDDLKISNLEF 362 W FPI+NE ++ + F EH+FL+ LE FP++GP+ F+ELV GL +NP+L+V++K + WF+ YF++ +D LK SN++F Sbjct: 311 WEFPINNEAGFD-DDGSEFHEHIFLEKHLESFPKQGPIRHFMELVTCGLSKNPYLSVKQKVEHIEWFRNYFNE-KKDILKESNIQF 394 The following BLAST results are available for this feature:
BLAST of TCONS_00069615-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|