Matrix metalloproteinase (polypeptide) - C. hemisphaerica

Overview


Name	Matrix metalloproteinase
Unique Name	TCONS_00070408-protein
Type	polypeptide
Organism	Clytia hemisphaerica (Jellyfish)
Sequence length	471

Sequence

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>TCONS_00070408-protein ID=TCONS_00070408-protein|Name=Matrix metalloproteinase|organism=Clytia hemisphaerica|type=polypeptide|length=471bp
MNEIKLFHTGIPASGILDEATVELMKTPRCGVKDVTGRLSGVKRKRRYTL
QGSKWMKKDLTWKLINDNNDGLTRQQVEDVMTQSFDKWHKITNLNFKKLE
HTDATEADIVVKFGVGSHGDPYHFDGRGGTLAHAFYPHNNLGLSGDVHFD
DDEVYTIGSSQGKSLLWVAVHEIGHSIGLEHSNLREAVMYPWYRGNGGRD
FDLNEDDVIGAQHIYGSRSPDPEESKTTTTTTLAPGETTPSLPPSVCINQ
FKAAILHKSTGKTYIINNGFVYTLGKQLGIESGPTPVKEIFPGVSNIDSL
YYNTDENIVVHDGKRYYTFNDINGRMIESGTIQNKYGLSDDVNKIDAAFI
WIGNGRVYLFVDKMYYRFDDNRASVDYGYPRVIKDNWKGLSESVDGVSIW
RNRVTYFFKGNSYYRFNDKRIRVEDNYPRPINHIWTQCTVAKLNTQNASV
TSKASILVTFGMLAIMKFLFL

Run BLAST on NCBI

Gene-mRNA-Prot

This polypeptide comes from the following gene feature:


Feature Name	Unique Name	Species	Type
XLOC_043847	XLOC_043847	Clytia hemisphaerica	gene

This polypeptide derives from the following transcript feature(s):


Feature Name	Unique Name	Species	Type
TCONS_00070408	TCONS_00070408	Clytia hemisphaerica	transcript

Annotated Terms

The following terms have been associated with this polypeptide:

Vocabulary: **INTERPRO**
Term	Definition
IPR021190	Pept_M10A
IPR018487	Hemopexin-like_repeat
IPR006026	Peptidase_Metallo
IPR024079	MetalloPept_cat_dom
IPR001818	Pept_M10_metallopeptidase
IPR000585	Hemopexin-like_dom
IPR033739	M10A_MMP
IPR002477	Peptidoglycan-bd-like

Vocabulary: **Molecular Function**
Term	Definition
GO:0008270	zinc ion binding
GO:0004222	metalloendopeptidase activity
GO:0008237	metallopeptidase activity

Vocabulary: **Biological Process**
Term	Definition
GO:0006508	proteolysis

Vocabulary: **Cellular Component**
Term	Definition
GO:0031012	extracellular matrix

GO Annotation

GO Assignments

This polypeptide is annotated with the following GO terms.

Category	Term Accession	Term Name
biological_process	GO:0006508	proteolysis
cellular_component	GO:0031012	extracellular matrix
molecular_function	GO:0004222	metalloendopeptidase activity
molecular_function	GO:0008237	metallopeptidase activity
molecular_function	GO:0008270	zinc ion binding

InterPro

Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
IPR021190	Peptidase M10A	PRINTS	PR00138	MATRIXIN	coord: 25..38 score: 55.23 coord: 107..135 score: 59.0 coord: 168..193 score: 59.99 coord: 81..96 score: 29.42 coord: 203..216 score: 53.66
IPR018487	Hemopexin-like repeats	SMART	SM00120	HX_rpt_3	coord: 394..438 e-value: 6.7E-9 score: 45.6 coord: 345..392 e-value: 4.3E-9 score: 46.2 coord: 251..296 e-value: 80.0 score: 1.3
IPR018487	Hemopexin-like repeats	PFAM	PF00045	Hemopexin	coord: 345..390 e-value: 1.0E-10 score: 41.3 coord: 394..435 e-value: 1.2E-10 score: 41.1
IPR018487	Hemopexin-like repeats	PROSITE	PS51642	HEMOPEXIN_2	coord: 248..294 score: 6.599
IPR018487	Hemopexin-like repeats	PROSITE	PS51642	HEMOPEXIN_2	coord: 391..438 score: 13.574
IPR018487	Hemopexin-like repeats	PROSITE	PS51642	HEMOPEXIN_2	coord: 342..390 score: 15.806
IPR006026	Peptidase, metallopeptidase	SMART	SM00235	col_5	coord: 51..217 e-value: 2.0E-36 score: 137.0
None	No IPR available	PIRSF	PIRSF001191	MMP_stromelysin	coord: 4..458 e-value: 4.9E-129 score: 429.2
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 213..239
None	No IPR available	SUPERFAMILY	55486	Metalloproteases ("zincins"), catalytic domain	coord: 47..217
IPR024079	Metallopeptidase, catalytic domain	GENE3D	3.40.390.10		coord: 3..224 e-value: 2.5E-62 score: 210.0
IPR001818	Peptidase M10, metallopeptidase	PFAM	PF00413	Peptidase_M10	coord: 54..216 e-value: 7.7E-49 score: 165.5
IPR000585	Hemopexin-like domain	GENE3D	2.110.10.10		coord: 245..441 e-value: 2.6E-40 score: 138.3
IPR000585	Hemopexin-like domain	CDD	cd00094	HX	coord: 261..438 e-value: 2.86782E-34 score: 126.272
IPR000585	Hemopexin-like domain	SUPERFAMILY	50923	Hemopexin-like domain	coord: 244..438
IPR033739	Peptidase M10A, catalytic domain	CDD	cd04278	ZnMc_MMP	coord: 54..216 e-value: 5.28459E-64 score: 205.131
IPR002477	Peptidoglycan binding-like	SUPERFAMILY	47090	PGBD-like	coord: 9..35

Blast

[Close]

BLAST of Matrix metalloproteinase vs. Swiss-Prot (Human)
Match: MMP24 (Matrix metalloproteinase-24 OS=Homo sapiens GN=MMP24 PE=2 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 3.043e-79
Identity = 154/461 (33.41%), Postives = 242/461 (52.49%), Query Frame = 0

Query:   10 GIPASGILDEATVELMKTPRCGVKDVTGRLSGVKRKRRYTLQGSKWMKKDLTWKLINDNNDGLTRQQVEDVMTQSFDKWHKITNLNFKKLEH----TDATEADIVVKFGVGSHGDPYHFDGRGGTLAHAFYPHNNLGLSGDVHFDDDEVYTIGSSQ--GKSLLWVAVHEIGHSIGLEHSNLREAVMYPWYRGNGGRDFDLNEDDVIGAQHIYGSRSPDPEESKTTTTTTL----APGE------------------TTPSLPPSVCINQFKAAILHKSTGKTYIINNGFVYTLGKQLGIESGPTPVKEIFPGV-SNIDSLYYNTDENIVVHDGKRYYTFNDINGRMIESGTIQNKYGLSDDVNK--IDAAFIWIGNGRVYLFVDKMYYRFDDNRASVDYGYPRVIKDNWKGLSESVDGVSIWRN-RVTYFFKGNSYYRFNDKRIRVEDNYPRPINHIWTQC 438
            GIP +G+LD+ T+E MK PRCGV D    LS  +R +RY L G KW +K +T+  I++    +        + Q+FD W K+T L F+++ +    +D  EADI++ F  G HGD   FDG GG LAHA++P    G+ GD HFD DE +T+G++   G  L  VAVHE+GH++GLEHS+   A+M P+Y+     +F L +DD+ G Q IYG  +   E ++   T  +    +P E                  +TP   P++C   F    L +  G+ ++  + + + L      E  P  +++ + G+ + ID+ Y   D   V   G +Y+ F ++    +E G   +   L   + +  ID A  W   G+ Y F  + Y+R+ + R + D GYP+ I   WKG+ ++  G  I +    TYF+KG  Y++F+++++ VE  YPR I   W  C
Sbjct:  119 GIPVTGVLDQTTIEWMKKPRCGVPD-HPHLSRRRRNKRYALTGQKWRQKHITYS-IHNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFP--GPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSSDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERQPRPPRPPLGDRPSTPGTKPNICDGNFNTVALFR--GEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVT---VEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPIT-VWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKLSVEPGYPRNILRDWMGC 569

The following BLAST results are available for this feature:

BLAST of Matrix metalloproteinase vs. Swiss-Prot (Human)

BLAST of Matrix metalloproteinase vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1


Match Name	E-value	Identity	Description
MMP24	3.043e-79	33.41	Matrix metalloproteinase-24 OS=Homo sapiens GN=MMP...	[more]

You are here

Matrix metalloproteinase (polypeptide) - C. hemisphaerica