Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00070484-protein ID=TCONS_00070484-protein|Name=TCONS_00070484-protein|organism=Clytia hemisphaerica|type=polypeptide|length=178bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00070484-protein vs. Swiss-Prot (Human)
Match: TLX3 (T-cell leukemia homeobox protein 3 OS=Homo sapiens GN=TLX3 PE=1 SV=3) HSP 1 Score: 90.1225 bits (222), Expect = 3.467e-22 Identity = 40/82 (48.78%), Postives = 60/82 (73.17%), Query Frame = 0 Query: 90 RRLGHPYTSRASPKRRAFRHTFTPYQVVQLEKLFEQSRYLSSSERMRMSRELKMTDNQLKTWYQNRRTKLKREITEMYDQQR 171 RR+GHPY +R PKR+ R +F+ Q+ +LEK F + +YL+S+ER +++ LKMTD Q+KTW+QNRRTK +R+ E + +R Sbjct: 152 RRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAER 233 The following BLAST results are available for this feature:
BLAST of TCONS_00070484-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|