Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00047608 ID=TCONS_00047608|Name=TCONS_00047608|organism=Clytia hemisphaerica|type=transcript|length=178bpRun BLAST on NCBI transcript from alignment at scaffold_132:204856..205033 Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00047608 ID=TCONS_00047608|Name=TCONS_00047608|organism=Clytia hemisphaerica|type=transcript|length=178bp|location=Sequence derived from alignment at scaffold_132:204856..205033 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
No biomaterial libraries express this feature.
Blast
BLAST of TCONS_00047608 vs. Swiss-Prot (Human)
Match: PRDM9 (Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2) HSP 1 Score: 86.6557 bits (213), Expect = 4.267e-21 Identity = 35/56 (62.50%), Postives = 46/56 (82.14%), Query Frame = -1 Query: 8 YGNWLRYINCSRTESEQNLVAFQYHGQIYYRAYKEMKIGDELLVWYGDEYARDLGI 175 + NW+RY+NC+R + EQNLVAFQYH QI+YR + ++ G ELLVWYGDEY ++LGI Sbjct: 312 WANWMRYVNCARDDEEQNLVAFQYHRQIFYRTCRVIRPGCELLVWYGDEYGQELGI 367 The following BLAST results are available for this feature:
BLAST of TCONS_00047608 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|