Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00047609 ID=TCONS_00047609|Name=TCONS_00047609|organism=Clytia hemisphaerica|type=transcript|length=146bpRun BLAST on NCBI transcript from alignment at scaffold_132:206375..206520 Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00047609 ID=TCONS_00047609|Name=TCONS_00047609|organism=Clytia hemisphaerica|type=transcript|length=146bp|location=Sequence derived from alignment at scaffold_132:206375..206520 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
No biomaterial libraries express this feature.
Blast
BLAST of TCONS_00047609 vs. Swiss-Prot (Human)
Match: ZN112 (Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=1 SV=2) HSP 1 Score: 75.0998 bits (183), Expect = 3.037e-17 Identity = 32/46 (69.57%), Postives = 38/46 (82.61%), Query Frame = -1 Query: 6 NLQKHLRTHTGDKPYKCDICGKRFSESSNLQKHLRTHTGDKPYKCD 143 +LQ H R HTG+KPYKC++CGK FS+ SNLQ H R HTG+KPYKCD Sbjct: 819 SLQAHHRVHTGEKPYKCEVCGKGFSQRSNLQAHQRVHTGEKPYKCD 864 The following BLAST results are available for this feature:
BLAST of TCONS_00047609 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|