Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00049544 ID=TCONS_00049544|Name=TCONS_00049544|organism=Clytia hemisphaerica|type=transcript|length=2329bpRun BLAST on NCBI transcript from alignment at scaffold_160:176217..183429- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00049544 ID=TCONS_00049544|Name=TCONS_00049544|organism=Clytia hemisphaerica|type=transcript|length=7213bp|location=Sequence derived from alignment at scaffold_160:176217..183429- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00049544 vs. Swiss-Prot (Human)
Match: RHG17 (Rho GTPase-activating protein 17 OS=Homo sapiens GN=ARHGAP17 PE=1 SV=1) HSP 1 Score: 120.939 bits (302), Expect = 5.474e-28 Identity = 52/99 (52.53%), Postives = 76/99 (76.77%), Query Frame = 1 Query: 31 IKDRDQRLQSLWTLVEKLPSENKVNLKYLICFLAKLAENSEVNKMTPSNIAIVVGPNMLWNDNDGG---VSIADTGNISIIVESLIEHSNWFFPEGCEF 318 ++D+D++LQ LW +KLP +N VN +YLI FLAKLA+ S+VNKMTPSNIAIV+GPN+LW N+G ++ A + ++ ++E +I+H++WFFPE EF Sbjct: 350 VQDQDKKLQDLWRTCQKLPPQNFVNFRYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWARNEGTLAEMAAATSVHVVAVIEPIIQHADWFFPEEVEF 448 The following BLAST results are available for this feature:
BLAST of TCONS_00049544 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|