Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00056459 ID=TCONS_00056459|Name=TCONS_00056459|organism=Clytia hemisphaerica|type=transcript|length=6239bpRun BLAST on NCBI protein sequence of TCONS_00056459-protein >TCONS_00056459-protein ID=TCONS_00056459-protein|Name=TCONS_00056459-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1472bp VAHCHANHNNGKNNTTTSNQSQSSKRYHLPPSTNENGLPFVRQPTSMKKDRun BLAST on NCBI transcript from alignment at scaffold_276:766212..783799+ Legend: exonfive_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00056459 ID=TCONS_00056459|Name=TCONS_00056459|organism=Clytia hemisphaerica|type=transcript|length=17588bp|location=Sequence derived from alignment at scaffold_276:766212..783799+ (Clytia hemisphaerica) Coding sequence (CDS) from alignment at scaffold_276:766212..783799+ >TCONS_00056459 ID=TCONS_00056459|Name=TCONS_00056459|organism=Clytia hemisphaerica|type=CDS|length=35352bp|location=Sequence derived from alignment at scaffold_276:766212..783799+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Annotated Terms
The following terms have been associated with this transcript:
Blast
BLAST of TCONS_00056459 vs. Swiss-Prot (Human)
Match: GAPR1 (Golgi-associated plant pathogenesis-related protein 1 OS=Homo sapiens GN=GLIPR2 PE=1 SV=3) HSP 1 Score: 81.6481 bits (200), Expect = 8.839e-17 Identity = 50/134 (37.31%), Postives = 77/134 (57.46%), Query Frame = 2 Query: 5837 KEFRQGMLLEHNKYRLIHQSPALQLDDQLSKKAQLYAAHVAKEGTVAHSNMSTRPNTGESVAELCTKGGVLPTPEHVVNKWYGEICDPGYNFNKKDKQPGTGHFSQLVWRNTRKLGIGLAVSNQADGESCSYVV 6238 K+F +L HN+YR H P L+L L+++AQ Y+ +A + HS S+R GE++A T + V ++WY EI + YNF + GTGHF+ +VW+NT+K+G+G A + +DG S+VV Sbjct: 7 KQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAWASYD----QTGKEVADRWYSEIKN--YNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASA--SDGS--SFVV 130 The following BLAST results are available for this feature:
BLAST of TCONS_00056459 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|