Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00057631 ID=TCONS_00057631|Name=TCONS_00057631|organism=Clytia hemisphaerica|type=transcript|length=184bpRun BLAST on NCBI transcript from alignment at scaffold_295:65..786+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00057631 ID=TCONS_00057631|Name=TCONS_00057631|organism=Clytia hemisphaerica|type=transcript|length=722bp|location=Sequence derived from alignment at scaffold_295:65..786+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
No biomaterial libraries express this feature.
Blast
BLAST of TCONS_00057631 vs. Swiss-Prot (Human)
Match: LRRC9 (Leucine-rich repeat-containing protein 9 OS=Homo sapiens GN=LRRC9 PE=2 SV=2) HSP 1 Score: 83.9593 bits (206), Expect = 4.453e-20 Identity = 38/61 (62.30%), Postives = 54/61 (88.52%), Query Frame = 2 Query: 2 QVTCLRLDGQHLSKISNLEKLENLKWASFNDNDITKIEGLDNCKDLIELSLANNCLSKVDG 184 ++T L LDGQHL +I+NLEKLENLKWASF++N++TK+EGL++C +L EL+L NC+SK++G Sbjct: 888 KITALNLDGQHLFEITNLEKLENLKWASFSNNNLTKMEGLESCINLEELTLDGNCISKIEG 948 The following BLAST results are available for this feature:
BLAST of TCONS_00057631 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|