Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00058193 ID=TCONS_00058193|Name=TCONS_00058193|organism=Clytia hemisphaerica|type=transcript|length=378bpRun BLAST on NCBI transcript from alignment at scaffold_308:231597..232060+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00058193 ID=TCONS_00058193|Name=TCONS_00058193|organism=Clytia hemisphaerica|type=transcript|length=464bp|location=Sequence derived from alignment at scaffold_308:231597..232060+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00058193 vs. Swiss-Prot (Human)
Match: WASP (Wiskott-Aldrich syndrome protein OS=Homo sapiens GN=WAS PE=1 SV=4) HSP 1 Score: 75.8702 bits (185), Expect = 1.369e-16 Identity = 34/71 (47.89%), Postives = 47/71 (66.20%), Query Frame = 1 Query: 172 NQRSQLLQDHENEEVFKLIGHRCKALSTVVAEVHLLV---NNEWKKEHVGVACFVKDSANKSYFIRLIDLK 375 N S LLQDHEN+ +F+++G +C L+T V +++L + W KEH G CFVKD+ KSYFIRL L+ Sbjct: 21 NIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQ 91 The following BLAST results are available for this feature:
BLAST of TCONS_00058193 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|