Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00058664 ID=TCONS_00058664|Name=TCONS_00058664|organism=Clytia hemisphaerica|type=transcript|length=302bpRun BLAST on NCBI transcript from alignment at scaffold_312:124026..125156+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00058664 ID=TCONS_00058664|Name=TCONS_00058664|organism=Clytia hemisphaerica|type=transcript|length=1131bp|location=Sequence derived from alignment at scaffold_312:124026..125156+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00058664 vs. Swiss-Prot (Human)
Match: ASPM (Abnormal spindle-like microcephaly-associated protein OS=Homo sapiens GN=ASPM PE=1 SV=2) HSP 1 Score: 83.5741 bits (205), Expect = 3.420e-19 Identity = 40/86 (46.51%), Postives = 58/86 (67.44%), Query Frame = -3 Query: 4 APTREVLSFRAYSLRRRMVQLRRSACRCYQSEDFRFVIHKIEKEVECGLISVRGEKHILADLGIKNQITKLLLSFNSLWLRIGLEV 261 APT+E +S RAY+ R R+ +LRR+ACR + SE I K+E E+E + VR ++H+ D+G + ++ LLS+N LWLRIGLE Sbjct: 745 APTKEEMSLRAYTARCRLNRLRRAACRLFTSEKMVKAIKKLEIEIEARRLIVRKDRHLWKDVGERQKVLNWLLSYNPLWLRIGLET 830 The following BLAST results are available for this feature:
BLAST of TCONS_00058664 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|