Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00059427 ID=TCONS_00059427|Name=TCONS_00059427|organism=Clytia hemisphaerica|type=transcript|length=266bpRun BLAST on NCBI transcript from alignment at scaffold_327:150399..150728- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00059427 ID=TCONS_00059427|Name=TCONS_00059427|organism=Clytia hemisphaerica|type=transcript|length=330bp|location=Sequence derived from alignment at scaffold_327:150399..150728- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00059427 vs. Swiss-Prot (Human)
Match: RHG39 (Rho GTPase-activating protein 39 OS=Homo sapiens GN=ARHGAP39 PE=1 SV=2) HSP 1 Score: 116.701 bits (291), Expect = 4.585e-31 Identity = 53/88 (60.23%), Postives = 67/88 (76.14%), Query Frame = -2 Query: 2 VPGDIDSVNALKLLIDKWEGTKNNVKDPHTPASLLKLWFRDLYEPLIPQRFYDQCIHNADSPEICLNIVNSLPDSNRIVFSYLIRLLQ 265 VPGDID VNALKL +D+W+ ++DPH PASLLKLW+R+L EPLIP FY+QCI + DSPE + +V++LP NR+V YLIR LQ Sbjct: 933 VPGDIDEVNALKLQVDQWK-VPTGLEDPHVPASLLKLWYRELEEPLIPHEFYEQCIAHYDSPEAAVAVVHALPRINRMVLCYLIRFLQ 1019 The following BLAST results are available for this feature:
BLAST of TCONS_00059427 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|