Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00063324 ID=TCONS_00063324|Name=TCONS_00063324|organism=Clytia hemisphaerica|type=transcript|length=278bpRun BLAST on NCBI transcript from alignment at scaffold_385:132666..132943 Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00063324 ID=TCONS_00063324|Name=TCONS_00063324|organism=Clytia hemisphaerica|type=transcript|length=278bp|location=Sequence derived from alignment at scaffold_385:132666..132943 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00063324 vs. Swiss-Prot (Human)
Match: HDAC7 (Histone deacetylase 7 OS=Homo sapiens GN=HDAC7 PE=1 SV=2) HSP 1 Score: 105.531 bits (262), Expect = 3.530e-27 Identity = 51/95 (53.68%), Postives = 63/95 (66.32%), Query Frame = 3 Query: 3 FNNVAIAARFAQSQG-VKKIFIVDWDVHHGNGTQDAFYEENEILYLSLHRYET---YPGLEKAKADRIGKGVGEGYNVNIAWGG--DQKMGETEY 269 FN+VAIA R Q Q KI IVDWDVHHGNGTQ FY++ +LY+SLHR++ +PG D +G G GEG+NVN+AW G D MG+ EY Sbjct: 682 FNSVAIACRQLQQQSKASKILIVDWDVHHGNGTQQTFYQDPSVLYISLHRHDDGNFFPG--SGAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEY 774 The following BLAST results are available for this feature:
BLAST of TCONS_00063324 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|