Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00063694 ID=TCONS_00063694|Name=TCONS_00063694|organism=Clytia hemisphaerica|type=transcript|length=140bpRun BLAST on NCBI transcript from alignment at scaffold_398:174541..175246+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00063694 ID=TCONS_00063694|Name=TCONS_00063694|organism=Clytia hemisphaerica|type=transcript|length=706bp|location=Sequence derived from alignment at scaffold_398:174541..175246+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
No biomaterial libraries express this feature.
Blast
BLAST of TCONS_00063694 vs. Swiss-Prot (Human)
Match: DUS1L (tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Homo sapiens GN=DUS1L PE=1 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 7.887e-16 Identity = 29/46 (63.04%), Postives = 42/46 (91.30%), Query Frame = 2 Query: 2 AKRLERAGAKIITVHGRRREQRGPLTGIASWDHIKAVKEAVSVPVF 139 A+ LE+AG +++TVHGR +EQ+GPL+G ASW+HIKAV++AV++PVF Sbjct: 161 AQMLEKAGCQLLTVHGRTKEQKGPLSGAASWEHIKAVRKAVAIPVF 206 The following BLAST results are available for this feature:
BLAST of TCONS_00063694 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|