Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00005457-protein ID=TCONS_00005457-protein|Name=TCONS_00005457-protein|organism=Clytia hemisphaerica|type=polypeptide|length=110bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00005457-protein vs. Swiss-Prot (Human)
Match: RS25 (40S ribosomal protein S25 OS=Homo sapiens GN=RPS25 PE=1 SV=1) HSP 1 Score: 119.013 bits (297), Expect = 4.581e-36 Identity = 67/82 (81.71%), Postives = 72/82 (87.80%), Query Frame = 0 Query: 28 KKWSKGKTRDKLNNAILFDKATYEKLYKEVPSYKLITPSVVSERLKIRGSLARQALKELLGKGLIKEVDDHRAQKIYTRATK 109 KKWSKGK RDKLNN +LFDKATY+KL KEVP+YKLITP+VVSERLKIRGSLAR AL+ELL KGLIK V HRAQ IYTR TK Sbjct: 33 KKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTK 114 The following BLAST results are available for this feature:
BLAST of TCONS_00005457-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|