Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00048332-protein ID=TCONS_00048332-protein|Name=TCONS_00048332-protein|organism=Clytia hemisphaerica|type=polypeptide|length=127bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00048332-protein vs. Swiss-Prot (Human)
Match: TXD17 (Thioredoxin domain-containing protein 17 OS=Homo sapiens GN=TXNDC17 PE=1 SV=1) HSP 1 Score: 108.227 bits (269), Expect = 1.392e-31 Identity = 51/107 (47.66%), Postives = 72/107 (67.29%), Query Frame = 0 Query: 21 ECKDASNIFVLCTGAEDPTTGKSWCPDCVKAEPVIENCLKSSKDTDVFIVAIAGDRPIWKNPDNEFRKHPKTLLKSIPTLIKWGTPERLSEGQCSDANLVSMMLEED 127 E + IF TG++D GKSWCPDCV+AEPV+ LK + VFI G++P WK+P+N+FRK+ K + ++PTL+K+GTP++L E +C ANLV M+ ED Sbjct: 20 EQHNGKTIFAYFTGSKD-AGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLK--VTAVPTLLKYGTPQKLVESECLQANLVEMLFSED 123 The following BLAST results are available for this feature:
BLAST of TCONS_00048332-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|