Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00048416-protein ID=TCONS_00048416-protein|Name=TCONS_00048416-protein|organism=Clytia hemisphaerica|type=polypeptide|length=111bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00048416-protein vs. Swiss-Prot (Human)
Match: RLA2 (60S acidic ribosomal protein P2 OS=Homo sapiens GN=RPLP2 PE=1 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 8.456e-19 Identity = 36/66 (54.55%), Postives = 50/66 (75.76%), Query Frame = 0 Query: 1 MRYVAAYLLAVLGGNETPSANDLKKILESSGVGFDAENADNVVSKLAGKTIAELIEEGSKKMASMP 66 MRYVA+YLLA LGGN +PSA D+KKIL+S G+ D + + V+S+L GK I ++I +G K+AS+P Sbjct: 1 MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVP 66 The following BLAST results are available for this feature:
BLAST of TCONS_00048416-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|