Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00053512-protein ID=TCONS_00053512-protein|Name=TCONS_00053512-protein|organism=Clytia hemisphaerica|type=polypeptide|length=123bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00053512-protein vs. Swiss-Prot (Human)
Match: FA11 (Coagulation factor XI OS=Homo sapiens GN=F11 PE=1 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 8.418e-16 Identity = 44/115 (38.26%), Postives = 60/115 (52.17%), Query Frame = 0 Query: 10 DKNTV---AFLSGWGRLRFGAR-QYKLQKAEVKIAANSKCV-----QGMTRRMICAA--TSCEDTCPGDSGGPLVVDLKKNQQFSLAGIVSWGRGCTFRNVQDVYTNVAALHQWI 113 D+N + +++GWG + + Q LQKA++ + N +C +T +MICA +D C GDSGGPL K N+ + L GI SWG GC R VYTNV WI Sbjct: 506 DRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQKRYRGHKITHKMICAGYREGGKDACKGDSGGPL--SCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWI 618 The following BLAST results are available for this feature:
BLAST of TCONS_00053512-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|