Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00057222-protein ID=TCONS_00057222-protein|Name=TCONS_00057222-protein|organism=Clytia hemisphaerica|type=polypeptide|length=129bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00057222-protein vs. Swiss-Prot (Human)
Match: ABCB8 (ATP-binding cassette sub-family B member 8, mitochondrial OS=Homo sapiens GN=ABCB8 PE=1 SV=3) HSP 1 Score: 98.5969 bits (244), Expect = 4.037e-25 Identity = 48/74 (64.86%), Postives = 59/74 (79.73%), Query Frame = 0 Query: 8 QATSALDAESEHLVQEAIDRAMVGRTVLVIAHRLSTVRDASRVIVINKGTIAEQGTHEELLELNGVYKKLVLRQ 81 +ATSALDAESE +VQEA+DRA GRTVLVIAHRLSTVR A ++V+ G + E GTHEELL+ G+Y +L+ RQ Sbjct: 637 EATSALDAESERVVQEALDRASAGRTVLVIAHRLSTVRGAHCIVVMADGRVWEAGTHEELLKKGGLYAELIRRQ 710 The following BLAST results are available for this feature:
BLAST of TCONS_00057222-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|