Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00057257-protein ID=TCONS_00057257-protein|Name=TCONS_00057257-protein|organism=Clytia hemisphaerica|type=polypeptide|length=252bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00057257-protein vs. Swiss-Prot (Human)
Match: BCL7A (B-cell CLL/lymphoma 7 protein family member A OS=Homo sapiens GN=BCL7A PE=1 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 4.827e-17 Identity = 33/49 (67.35%), Postives = 40/49 (81.63%), Query Frame = 0 Query: 19 SFRLETRSRAKDEIKRVMMTIEKVRKWEKKWVHVGPPTCTMKVFKWMPV 67 S R ETRSRAKD+IKRVM IEKVRKWEKKWV VG +++++KW+PV Sbjct: 5 SVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVG--DTSLRIYKWVPV 51 The following BLAST results are available for this feature:
BLAST of TCONS_00057257-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|