Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00058071-protein ID=TCONS_00058071-protein|Name=TCONS_00058071-protein|organism=Clytia hemisphaerica|type=polypeptide|length=205bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00058071-protein vs. Swiss-Prot (Human)
Match: CL065 (Probable peptide chain release factor C12orf65, mitochondrial OS=Homo sapiens GN=C12orf65 PE=2 SV=1) HSP 1 Score: 93.2041 bits (230), Expect = 4.117e-24 Identity = 39/69 (56.52%), Postives = 55/69 (79.71%), Query Frame = 0 Query: 99 FLTLNEDEIEEKFIRGSGPGGQKINKTSSCVELKHIKTGIIVKCQESRSQDQNRKIARSRMLEKLKQMF 167 L+L+E+E+EE+F++G GPGGQ NKTS+CV LKHI +GI+VKC ++RS DQNRK+AR + EK+ + Sbjct: 52 LLSLDENELEEQFVKGHGPGGQATNKTSNCVVLKHIPSGIVVKCHQTRSVDQNRKLARKILQEKVDVFY 120 The following BLAST results are available for this feature:
BLAST of TCONS_00058071-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|