Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00058305-protein ID=TCONS_00058305-protein|Name=TCONS_00058305-protein|organism=Clytia hemisphaerica|type=polypeptide|length=101bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00058305-protein vs. Swiss-Prot (Human)
Match: P2RX4 (P2X purinoceptor 4 OS=Homo sapiens GN=P2RX4 PE=1 SV=2) HSP 1 Score: 76.6406 bits (187), Expect = 6.244e-18 Identity = 36/86 (41.86%), Postives = 57/86 (66.28%), Query Frame = 0 Query: 14 LLTYETGKVVEIQNKKVGIWYRSIQIAIIIYVIGYVIIYDKGYQATDSAISSTNTKVKGITHVDFGNFPSTLFNGRRVYDPEDYVV 99 L Y+T ++V I+++KVG+ R++Q+ I+ YVIG+V +++KGYQ TDS +SS TKVKG+ + G R++D DYV+ Sbjct: 12 LFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKL------GFRIWDVADYVI 91 The following BLAST results are available for this feature:
BLAST of TCONS_00058305-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|