Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00058459-protein ID=TCONS_00058459-protein|Name=TCONS_00058459-protein|organism=Clytia hemisphaerica|type=polypeptide|length=106bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00058459-protein vs. Swiss-Prot (Human)
Match: SIM14 (Small integral membrane protein 14 OS=Homo sapiens GN=SMIM14 PE=1 SV=1) HSP 1 Score: 91.2781 bits (225), Expect = 1.878e-25 Identity = 41/80 (51.25%), Postives = 57/80 (71.25%), Query Frame = 0 Query: 7 FDPCECIFSPAGAMRRLISLLRQSQNYCTDDQCFGNPPGPNQNEDTGMTMFMMFIAWVVVAAALYLFRPTSVRDGSKPAR 86 FDPCEC+ S AMRRLI+LLRQSQ+YCTD +C PGP+ D G+++ M+ +AW+V+A L+L RP ++R S P + Sbjct: 6 FDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSG--DNGISVTMILVAWMVIALILFLLRPPNLRGSSLPGK 83 The following BLAST results are available for this feature:
BLAST of TCONS_00058459-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|