Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00058554-protein ID=TCONS_00058554-protein|Name=TCONS_00058554-protein|organism=Clytia hemisphaerica|type=polypeptide|length=412bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00058554-protein vs. Swiss-Prot (Human)
Match: DMRT3 (Doublesex- and mab-3-related transcription factor 3 OS=Homo sapiens GN=DMRT3 PE=1 SV=1) HSP 1 Score: 87.8113 bits (216), Expect = 9.653e-19 Identity = 35/54 (64.81%), Postives = 43/54 (79.63%), Query Frame = 0 Query: 33 RTPKCARCRNHGLDRELKGHKEKCEFKDCTCRSCLVVVERQKITAARVAHLRQQ 86 RTPKCARCRNHG+ LKGHK C FKDCTC C++++ERQ++ AA+VA RQQ Sbjct: 25 RTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCILIIERQRVMAAQVALRRQQ 78 The following BLAST results are available for this feature:
BLAST of TCONS_00058554-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|