Sequence
The following sequences are available for this feature:
polypeptide sequence
>TCONS_00062079-protein ID=TCONS_00062079-protein|Name=TCONS_00062079-protein|organism=Clytia hemisphaerica|type=polypeptide|length=381bp MAEEPKEIPSSTSNEQATTETTVPPLKGVEVEINKKVHEEQNEKANEEQS EKANEEKSEKANEEQKKEQVTEEEKMEVEESGEQEKAQLLEEEELLMEES GETTDTSSEKANESRDYFDEDEMFQCLECKTKECAMWRKSKDKQGVICNL CHLERIKGDSATNAPGQGGTNSNNNAASSSTSKTSSSLMQPPMKAKDVRI SKRKNKQNKKFTNGFYGDRIIKSGHSKSRRSLYKRKPMKSVLGSSTIVAS QSIYHDGLLYRVGDIVCTSDIEGGTYYAQLRGFLQDEYCEKSAVITWLIP TKRNVTKFDPMLFVPGLDEETPRPMSCFSFVCRASTNLFKAPNMHPPYHR SQCDLNDLIHVANAMNTESTEDHQLTTEGES Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following
gene feature:
This polypeptide derives from the following
transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term Definition
IPR013088 Znf_NHR/GATA
Vocabulary: Biological Process
Term Definition
GO:0006355 regulation of transcription, DNA-templated
Vocabulary: Molecular Function
Term Definition
GO:0008270 zinc ion binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category
Term Accession
Term Name
biological_process
GO:0006355
regulation of transcription, DNA-templated
molecular_function
GO:0008270
zinc ion binding
InterPro
Analysis Name:
InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
50 100 150 200 250 300 350 Score = Score = Score = Score = Expect = 1.0E-5 / Score = 24.7 Sequence Coil mobidb-lite mobidb-lite SSF57716 G3DSA:3.30.50.10
IPR Term IPR Description Source Source Term Source Description Alignment
None No IPR available COILS Coil Coil coord: 28..93
None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 159..203
None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 1..116
None No IPR available SUPERFAMILY 57716 Glucocorticoid receptor-like (DNA-binding domain) coord: 121..157
IPR013088 Zinc finger, NHR/GATA-type GENE3D 3.30.50.10 coord: 119..210 e-value: 1.0E-5 score: 24.7
Blast
BLAST of TCONS_00062079-protein vs. Swiss-Prot (Human)
Match:
GATD1 (GATA zinc finger domain-containing protein 1 OS=Homo sapiens GN=GATAD1 PE=1 SV=1)
HSP 1 Score: 117.472 bits (293), Expect = 1.390e-30
Identity = 78/228 (34.21%), Postives = 121/228 (53.07%), Query Frame = 0
Query: 126 CLECKTKECAMWRKSKDKQG-VICNLCHLERIKGDSATNAPGQGGTNSNNNAASSSTSKTSSSLMQPP-------MKAKDVRISKRKNK-QNKKFTNGFYGDRIIKSGHSKSRRSLYKRK-PMKSVLGSSTIVASQSIYHDGLLYRVGDIVCTSD-IEGGTYYAQLRGFLQDEYCEKSAVITWLIPTKRNVT-KFDPMLFVPGLDEETPRPMSCFSFVCRASTNLFKA 341
C CKT +MW+K QG ++C+ C R S G G + + +S+ PP K I +R + +N K+ + ++ + S K RR ++K K P+K+ STI+ ++SI++ G+ Y++GD+V D +G YYAQ+RGF+QD+YCEKSA +TWLIPT + +FDP ++ G +E+ PR M FVC A + FK+
Sbjct: 9 CSVCKTTSSSMWKKGA--QGEILCHHC-TGRGGAGSGGAGSGAAGGTGGSGGGGFGAATFASTSATPPQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAEKKV-STKGKGRRHIFKLKNPIKAPESVSTIITAESIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIPTLSSPRDQFDPASYIIGPEEDLPRKMEYLEFVCHAPSEYFKS 232
The following BLAST results are available for this feature:
BLAST of TCONS_00062079-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (
Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens) )
Total hits: 1
M A E E P K E I P S S T S N E Q A T T E T T V P P L K G V E V E I N K K V H E E Q N E K A N E E Q S E K A N E E K S E K A N E E Q K K E Q V T E E E K M E V E E S G E Q E K A Q L L E E E E L L M E E S G E T T D T S S E K A N E S R D Y F D E D E M F Q C L E C K T K E C A M W R K S K D K Q G V I C N L C H L E R I K G D S A T N A P G Q G G T N S N N N A A S S S T S K T S S S L M Q P P M K A K D V R I S K R K N K Q N K K F T N G F Y G D R I I K S G H S K S R R S L Y K R K P M K S V L G S S T I V A S Q S I Y H D G L L Y R V G D I V C T S D I E G G T Y Y A Q L R G F L Q D E Y C E K S A V I T W L I P T K R N V T K F D P M L F V P G L D E E T P R P M S C F S F V C R A S T N L F K A P N M H P P Y H R S Q C D L N D L I H V A N A M N T E S T E D H Q L T T E G E S 50 100 150 200 250 300 350 Expect = 1.39e-30 / Id = 34.21 Sequence GATD1
Match Name E-value Identity Description
GATD1 1.390e-30 34.21 GATA zinc finger domain-containing protein 1 OS=Ho... [more]
back to top