Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00062327-protein ID=TCONS_00062327-protein|Name=TCONS_00062327-protein|organism=Clytia hemisphaerica|type=polypeptide|length=190bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00062327-protein vs. Swiss-Prot (Human)
Match: FUND1 (FUN14 domain-containing protein 1 OS=Homo sapiens GN=FUNDC1 PE=1 SV=1) HSP 1 Score: 82.0333 bits (201), Expect = 4.741e-20 Identity = 38/110 (34.55%), Postives = 65/110 (59.09%), Query Frame = 0 Query: 81 HSTYIQLGIGGATGLLTGHMVGKVGKAMAAGIGGTILLINMGTRAGYITVDWEKVDADMRTASEQISEKIAEQQQNEETQELLKKGGLFIRRNLVMLGGFAAGFFLGMAT 190 +S Q+ +GG TG G + KVGK A +GG LL+ + + +GY+ +DW++V+ D+ A QI ++ + E L+++ FI++N+V+ GF GF LG+A+ Sbjct: 48 YSVATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKR--ANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS 155 The following BLAST results are available for this feature:
BLAST of TCONS_00062327-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|