Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00062556-protein ID=TCONS_00062556-protein|Name=Nanos2|organism=Clytia hemisphaerica|type=polypeptide|length=305bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of Nanos2 vs. Swiss-Prot (Human)
Match: NANO1 (Nanos homolog 1 OS=Homo sapiens GN=NANOS1 PE=1 SV=2) HSP 1 Score: 101.679 bits (252), Expect = 4.246e-25 Identity = 38/59 (64.41%), Postives = 51/59 (86.44%), Query Frame = 0 Query: 197 VQVCVFCRNNGESESVYTSHVLKDTDGRTSCPILRAYTCPICKANGDNSHTIKYCPMNQ 255 +QVCVFCRNN E+ ++YT+H+LK DGR CP+LR YTCP+C A+GDN+HTIKYCP+++ Sbjct: 211 LQVCVFCRNNKEAMALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCPLSK 269 The following BLAST results are available for this feature:
BLAST of Nanos2 vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|