Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00057953 ID=TCONS_00057953|Name=TCONS_00057953|organism=Clytia hemisphaerica|type=transcript|length=3037bpRun BLAST on NCBI transcript from alignment at scaffold_302:111082..119033- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00057953 ID=TCONS_00057953|Name=TCONS_00057953|organism=Clytia hemisphaerica|type=transcript|length=7952bp|location=Sequence derived from alignment at scaffold_302:111082..119033- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00057953 vs. Swiss-Prot (Human)
Match: FAK1 (Focal adhesion kinase 1 OS=Homo sapiens GN=PTK2 PE=1 SV=2) HSP 1 Score: 106.301 bits (264), Expect = 3.406e-23 Identity = 53/99 (53.54%), Postives = 73/99 (73.74%), Query Frame = 2 Query: 1781 ANDIVYQHTTSVVKSVIEFNTGVQHAQPEEFVDLVKVVGLNLRDLLAEVDNGVQNIPESAQKEIEMAHKVLSSDMAELVAKMKLAQKYAETTLGQENKR 2077 +ND VY++ T +VK+VIE ++ +Q A PEE+V +VK VGL LR LLA VD + +P S +EIEMA K+L+SD+ EL+ KMKLAQ+Y T+L QE K+ Sbjct: 920 SNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKK 1018 The following BLAST results are available for this feature:
BLAST of TCONS_00057953 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|