Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00058231 ID=TCONS_00058231|Name=TCONS_00058231|organism=Clytia hemisphaerica|type=transcript|length=5112bpRun BLAST on NCBI protein sequence of TCONS_00058231-protein >TCONS_00058231-protein ID=TCONS_00058231-protein|Name=TCONS_00058231-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1160bp MADSDEQRRTLLYQKMGELESTDDIDERRELRRQIRELRNKKFDEEMKKIRun BLAST on NCBI transcript from alignment at scaffold_309:435879..468623+ Legend: exonfive_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00058231 ID=TCONS_00058231|Name=TCONS_00058231|organism=Clytia hemisphaerica|type=transcript|length=32745bp|location=Sequence derived from alignment at scaffold_309:435879..468623+ (Clytia hemisphaerica) Coding sequence (CDS) from alignment at scaffold_309:435879..468623+ >TCONS_00058231 ID=TCONS_00058231|Name=TCONS_00058231|organism=Clytia hemisphaerica|type=CDS|length=41796bp|location=Sequence derived from alignment at scaffold_309:435879..468623+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Annotated Terms
The following terms have been associated with this transcript:
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Blast
BLAST of TCONS_00058231 vs. Swiss-Prot (Human)
Match: CYTSA (Cytospin-A OS=Homo sapiens GN=SPECC1L PE=1 SV=2) HSP 1 Score: 114.39 bits (285), Expect = 3.039e-25 Identity = 45/99 (45.45%), Postives = 66/99 (66.67%), Query Frame = 1 Query: 3304 LLAWTQHQLMGYKGVDIENFSESWADGLAFAALMHSFFPEDVPIEELSKDTQRRNFEIAFQIATEEGVMDLLDIEDMVRMKSPDPKSIITYLNDVYRVF 3600 LL W Q + GY+ +DI NFS SW DGLAF AL+H++ P +P +EL+ +RRNF +AFQ A G+ LDI +MVR + PD ++++ Y+ +Y+ F Sbjct: 1017 LLKWCQKKTEGYQNIDITNFSSSWNDGLAFCALLHTYLPAHIPYQELNSQDKRRNFMLAFQAAESVGIKSTLDINEMVRTERPDWQNVMLYVTAIYKYF 1115 The following BLAST results are available for this feature:
BLAST of TCONS_00058231 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|