Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00049800-protein ID=TCONS_00049800-protein|Name=TCONS_00049800-protein|organism=Clytia hemisphaerica|type=polypeptide|length=125bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00049800-protein vs. Swiss-Prot (Human)
Match: LAMB2 (Laminin subunit beta-2 OS=Homo sapiens GN=LAMB2 PE=1 SV=2) HSP 1 Score: 108.227 bits (269), Expect = 1.931e-28 Identity = 51/100 (51.00%), Postives = 67/100 (67.00%), Query Frame = 0 Query: 26 CQRGGCFPATGDLLVGREDRISATSTCGLKGPEEYCIVSFLNNKKKCFRCESTREVDLTPESYKYSHLPKYMVTTSPKDRLKGWWQAQNGEQEVQIQVIL 125 C RG C+PATGDLLVGR DR++A+STCGL GP+ YCIVS L ++KKCF C+S R + +SH + +VT+ R WWQ++NG V IQ+ L Sbjct: 42 CSRGSCYPATGDLLVGRADRLTASSTCGLNGPQPYCIVSHLQDEKKCFLCDSRRP--FSARDNPHSHRIQNVVTSFAPQRRAAWWQSENGIPAVTIQLDL 139 The following BLAST results are available for this feature:
BLAST of TCONS_00049800-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|