Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00051106-protein ID=TCONS_00051106-protein|Name=TCONS_00051106-protein|organism=Clytia hemisphaerica|type=polypeptide|length=111bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00051106-protein vs. Swiss-Prot (Human)
Match: DNLI3 (DNA ligase 3 OS=Homo sapiens GN=LIG3 PE=1 SV=2) HSP 1 Score: 82.4185 bits (202), Expect = 9.406e-20 Identity = 42/98 (42.86%), Postives = 62/98 (63.27%), Query Frame = 0 Query: 13 FWKLCKRLSNESSYKLKTSLIKEYITKKSDNSGKYQGNLYLLAKFLLPGKEKRIYNVKDKQLLKYFSQIFKTDLKSMTEHLEKQGVVSDTVMDFFSKS 110 F KLC +++ SY KT +I++++ K S G + G++YL K LLPG K +YN+ DKQ++K FS+IF + M LE QG VS+T+ FF +S Sbjct: 266 FRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDG-FHGDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLE-QGDVSETIRVFFEQS 361 The following BLAST results are available for this feature:
BLAST of TCONS_00051106-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|