Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00057627-protein ID=TCONS_00057627-protein|Name=TCONS_00057627-protein|organism=Clytia hemisphaerica|type=polypeptide|length=323bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00057627-protein vs. Swiss-Prot (Human)
Match: ZFP37 (Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3) HSP 1 Score: 78.9518 bits (193), Expect = 3.107e-16 Identity = 45/118 (38.14%), Postives = 61/118 (51.69%), Query Frame = 0 Query: 189 VSSNSNEVSKAFPCLLCAESFLLKKELEQHIIEAHESVLYECKICGKKYKDKNVFKIHFQRHG--KTFQCKECGKILRSQSTLKNHAYTHQKVKPYKCRFCDKTFAYSNGRNYHIKTH 304 V S++ E K + C C +SF L +H+ + YEC CGK +K + H + H K F+C ECGK +S L H TH K KPYKC C K F +S+ YH++TH Sbjct: 396 VRSHTGE--KPYECKECGKSFRYNSSLTEHVRTHTGEIPYECNECGKAFKYSSSLTKHMRIHTGEKPFECNECGKAFSKKSHLIIHQRTHTKEKPYKCNECGKAFGHSSSLTYHMRTH 511 The following BLAST results are available for this feature:
BLAST of TCONS_00057627-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|