Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00057700-protein ID=TCONS_00057700-protein|Name=TCONS_00057700-protein|organism=Clytia hemisphaerica|type=polypeptide|length=102bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00057700-protein vs. Swiss-Prot (Human)
Match: RM15 (39S ribosomal protein L15, mitochondrial OS=Homo sapiens GN=MRPL15 PE=1 SV=1) HSP 1 Score: 85.5001 bits (210), Expect = 1.533e-21 Identity = 39/69 (56.52%), Postives = 51/69 (73.91%), Query Frame = 0 Query: 11 HKGQGQRGTMPRIGFEGGQTPFYRLVPKHGFTNA-KFKKEYTPVSLGRLQYFIDSQRIDPNEKITIETL 78 HKG+ QRGT PR+GFEGGQTPFY +PK+GF F+++Y P+SL RLQY ID R+DP++ I + L Sbjct: 53 HKGERQRGTRPRLGFEGGQTPFYIRIPKYGFNEGHSFRRQYKPLSLNRLQYLIDLGRVDPSQPIDLTQL 121 The following BLAST results are available for this feature:
BLAST of TCONS_00057700-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|